alpha Sarcoglycan (SGCA) (NM_000023) Human Mass Spec Standard
CAT#: PH306577
SGCA MS Standard C13 and N15-labeled recombinant protein (NP_000014)
View other "alpha Sarcoglycan" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | SGCA MS Standard C13 and N15-labeled recombinant protein (NP_000014) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206577 |
| Predicted MW | 42.9 kDa |
| Protein Sequence |
>RC206577 protein sequence
Red=Cloning site Green=Tags(s) MAETLFWTPLLVVLLAGLGDTEAQQTTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHP DLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLV RSHDAEEVLPSTPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCL KMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTE APDRDFLVDALVTLLVPLLVALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAAS REVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000014 |
| RefSeq Size | 1441 |
| RefSeq ORF | 1161 |
| Synonyms | 50DAG; adhalin; ADL; DAG2; DMDA2; LGMD2D; LGMDR3; SCARMD1 |
| Locus ID | 6442 |
| Cytogenetics | 17q21.33 |
| Summary | This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400004 | SGCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400004 | Transient overexpression lysate of sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein) (SGCA), transcript variant 1 |
CNY 3080.00 |
|
| TP306577 | Recombinant protein of human sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein) (SGCA), transcript variant 1, 20 µg |
CNY 2900.00 |
其它alpha Sarcoglycan产品
