CART (CARTPT) (NM_004291) Human Mass Spec Standard
CAT#: PH306552
CARTPT MS Standard C13 and N15-labeled recombinant protein (NP_004282)
View other "CART" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CARTPT MS Standard C13 and N15-labeled recombinant protein (NP_004282) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206552 |
Predicted MW | 12.8 kDa |
Protein Sequence |
>RC206552 protein sequence
Red=Cloning site Green=Tags(s) MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVP IYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004282 |
RefSeq Size | 933 |
RefSeq ORF | 348 |
Synonyms | CART |
Locus ID | 9607 |
Cytogenetics | 5q13.2 |
Summary | This gene encodes a preproprotein that is proteolytically processed to generate multiple biologically active peptides. These peptides play a role in appetite, energy balance, maintenance of body weight, reward and addiction, and the stress response. Expression of a similar gene transcript in rodents is upregulated following administration of cocaine and amphetamine. Mutations in this gene are associated with susceptibility to obesity in humans. [provided by RefSeq, Feb 2016] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418081 | CARTPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418081 | Transient overexpression lysate of CART prepropeptide (CARTPT) |
CNY 3080.00 |
|
TP306552 | Recombinant protein of human CART prepropeptide (CARTPT), 20 µg |
CNY 2900.00 |