HBZ (NM_005332) Human Mass Spec Standard
CAT#: PH306504
HBZ MS Standard C13 and N15-labeled recombinant protein (NP_005323)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HBZ MS Standard C13 and N15-labeled recombinant protein (NP_005323) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206504 |
| Predicted MW | 15.6 kDa |
| Protein Sequence |
>RC206504 protein sequence
Red=Cloning site Green=Tags(s) MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDA VKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEK YR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005323 |
| RefSeq Size | 589 |
| RefSeq ORF | 426 |
| Synonyms | HBAZ; HBZ-T1; HBZ1 |
| Locus ID | 3050 |
| Cytogenetics | 16p13.3 |
| Summary | Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult life. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'. [provided by RefSeq, Nov 2009] |
| Protein Families | Embryonic stem cells, ES Cell Differentiation/IPS |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417379 | HBZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417379 | Transient overexpression lysate of hemoglobin, zeta (HBZ) |
CNY 3080.00 |
|
| TP306504 | Recombinant protein of human hemoglobin, zeta (HBZ), 20 µg |
CNY 2900.00 |
|
| TP720205 | Recombinant protein of human hemoglobin, zeta (HBZ) |
CNY 1800.00 |

