LAIR1 (NM_002287) Human Mass Spec Standard
CAT#: PH306439
LAIR1 MS Standard C13 and N15-labeled recombinant protein (NP_002278)
View other "LAIR1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LAIR1 MS Standard C13 and N15-labeled recombinant protein (NP_002278) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206439 |
| Predicted MW | 31.4 kDa |
| Protein Sequence |
>RC206439 protein sequence
Red=Cloning site Green=Tags(s) MSPHPTALLGLVLCLAQTIHTQEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYND TEDVSQASPSESEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGP TQRPSDNSHNEHAPASQGLKAEHLYILIGVSVVFLFCLLLLVLFCLHRQNQIKQGPPRSKDEEQKPQQRP DLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESIT YAAVARH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002278 |
| RefSeq Size | 2818 |
| RefSeq ORF | 861 |
| Synonyms | CD305; LAIR-1 |
| Locus ID | 3903 |
| Cytogenetics | 19q13.42 |
| Summary | The protein encoded by this gene is an inhibitory receptor found on peripheral mononuclear cells, including natural killer cells, T cells, and B cells. Inhibitory receptors regulate the immune response to prevent lysis of cells recognized as self. The gene is a member of both the immunoglobulin superfamily and the leukocyte-associated inhibitory receptor family. The gene maps to a region of 19q13.4 called the leukocyte receptor cluster, which contains at least 29 genes encoding leukocyte-expressed receptors of the immunoglobulin superfamily. The encoded protein has been identified as an anchor for tyrosine phosphatase SHP-1, and may induce cell death in myeloid leukemias. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411939 | LAIR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419415 | LAIR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411939 | Transient overexpression lysate of leukocyte-associated immunoglobulin-like receptor 1 (LAIR1), transcript variant b |
CNY 3080.00 |
|
| LY419415 | Transient overexpression lysate of leukocyte-associated immunoglobulin-like receptor 1 (LAIR1), transcript variant a |
CNY 3080.00 |
|
| TP306439 | Recombinant protein of human leukocyte-associated immunoglobulin-like receptor 1 (LAIR1), transcript variant a, 20 µg |
CNY 2900.00 |
