Alpha 2 Antiplasmin (SERPINF2) (NM_000934) Human Mass Spec Standard
CAT＃: PH306435
SERPINF2 MS Standard C13 and N15-labeled recombinant protein (NP_000925)
View other "Alpha 2 Antiplasmin" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
CNY 3080.00
CNY 6281.00
Specifications
| Product Data | |
| Description | SERPINF2 MS Standard C13 and N15-labeled recombinant protein (NP_000925) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206435 |
| Predicted MW | 54.6 kDa |
| Protein Sequence |
>RC206435 protein sequence
Red=Cloning site Green=Tags(s) MVLLWGLLVLSWSCLQGPCSVFSPVSAMEPLGRQLTSGPNQEQVSPLTLLKLGNQEPGGQTALKSPPGVC SRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSHLALGAQNHTLQRLQQVLHAGS GPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLEQSEQLFGAKPVSLTGKQEDDLANINQWVKE ATEGKIQEFLSGLPEDTVLLLLNAIHFQGFWRNKFDPSLTQRDSFHLDEQFTVPVEMMQARTYPLRWFLL EQPEIQVAHFPFKNNMSFVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVAT LSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIF EDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPMEEDYPQFGSP K myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000925 |
| RefSeq Size | 2284 |
| RefSeq ORF | 1473 |
| Synonyms | A2AP; AAP; ALPHA-2-PI; alpha2AP; API; PLI |
| Locus ID | 5345 |
| Cytogenetics | 17p13.3 |
| Summary | This gene encodes a member of the serpin family of serine protease inhibitors. The protein is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in this gene result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Complement and coagulation cascades |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424449 | SERPINF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431370 | SERPINF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424449 | Transient overexpression lysate of serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), transcript variant 1 |
CNY 3080.00 |
|
| LY431370 | Transient overexpression lysate of serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), transcript variant 3 |
CNY 3080.00 |
|
| TP306435 | Recombinant protein of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), 20 µg |
CNY 2900.00 |
|
| TP328342 | Recombinant protein of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP701066 | Purified recombinant protein of Human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |
|
| TP762699 | Purified recombinant protein of Human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), transcript variant 1, Asn40-End, with C-terminal His tag, expressed in E.coli, 50ug |
CNY 2480.00 |
其它Alpha 2 Antiplasmin产品
Purified recombinant protein of Human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug
