CD200 (NM_005944) Human Mass Spec Standard
CAT＃: PH306356
CD200 MS Standard C13 and N15-labeled recombinant protein (NP_005935)
View other "CD200" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | CD200 MS Standard C13 and N15-labeled recombinant protein (NP_005935) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206356 |
| Predicted MW | 30.3 kDa |
| Protein Sequence |
>RC206356 protein sequence
Red=Cloning site Green=Tags(s) MERLVIRMPFCHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAV SPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVY VQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGK EVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005935 |
| RefSeq Size | 2226 |
| RefSeq ORF | 807 |
| Synonyms | MOX1; MOX2; MRC; OX-2 |
| Locus ID | 4345 |
| Cytogenetics | 3q13.2 |
| Summary | This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401799 | CD200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424074 | CD200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401799 | Transient overexpression lysate of CD200 molecule (CD200), transcript variant 1 |
CNY 3080.00 |
|
| LY424074 | Transient overexpression lysate of CD200 molecule (CD200), transcript variant 2 |
CNY 3080.00 |
|
| PH317941 | CD200 MS Standard C13 and N15-labeled recombinant protein (NP_001004196) |
CNY 14250.00 |
|
| TP306356 | Recombinant protein of human CD200 molecule (CD200), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP317941 | Purified recombinant protein of Homo sapiens CD200 molecule (CD200), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP724003 | Human CD200 Protein, His Tag |
CNY 4925.00 |
