PBP (PEBP1) (NM_002567) Human Mass Spec Standard
CAT#: PH306355
PEBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002558)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PEBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002558) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206355 |
| Predicted MW | 21.1 kDa |
| Protein Sequence |
>RC206355 protein sequence
Red=Cloning site Green=Tags(s) MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTD PDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSN RSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002558 |
| RefSeq Size | 1507 |
| RefSeq ORF | 561 |
| Synonyms | HCNP; HCNPpp; HEL-210; HEL-S-34; HEL-S-96; PBP; PEBP; PEBP-1; RKIP |
| Locus ID | 5037 |
| Cytogenetics | 12q24.23 |
| Summary | This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The encoded protein can be further processed to form a smaller cleavage product, hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in neural development. This gene has been implicated in numerous human cancers and may act as a metastasis suppressor gene. Multiple pseudogenes of this gene have been identified in the genome. [provided by RefSeq, Jul 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400913 | PEBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400913 | Transient overexpression lysate of phosphatidylethanolamine binding protein 1 (PEBP1) |
CNY 3080.00 |
|
| TP306355 | Recombinant protein of human phosphatidylethanolamine binding protein 1 (PEBP1), 20 µg |
CNY 2900.00 |
