MOB4A (MOB1B) (NM_173468) Human Mass Spec Standard
CAT#: PH306337
MOBKL1A MS Standard C13 and N15-labeled recombinant protein (NP_775739)
View other "MOB4A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | MOBKL1A MS Standard C13 and N15-labeled recombinant protein (NP_775739) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206337 |
| Predicted MW | 25.1 kDa |
| Protein Sequence |
>RC206337 protein sequence
Red=Cloning site Green=Tags(s) MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINM LYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF PKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK LTSKDR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_775739 |
| RefSeq Size | 6979 |
| RefSeq ORF | 648 |
| Synonyms | MATS2; MOB4A; MOBKL1A |
| Locus ID | 92597 |
| Cytogenetics | 4q13.3 |
| Summary | The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406621 | MOB1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406621 | Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 1A (yeast) (MOBKL1A) |
CNY 3080.00 |
|
| TP306337 | Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1A (yeast) (MOBKL1A), 20 µg |
CNY 2900.00 |
