C14orf142 (GON7) (NM_032490) Human Mass Spec Standard
CAT#: PH306178
C14orf142 MS Standard C13 and N15-labeled recombinant protein (NP_115879)
View other "C14orf142" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C14orf142 MS Standard C13 and N15-labeled recombinant protein (NP_115879) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206178 |
Predicted MW | 10.9 kDa |
Protein Sequence |
>RC206178 protein sequence
Red=Cloning site Green=Tags(s) MELLGEYVGQEGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRVAAAPDEDLDG DDEDDAEDENNIDNRTNFDGPSAKRPKTPS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115879 |
RefSeq Size | 1191 |
RefSeq ORF | 300 |
Synonyms | C14orf142; PNAS-127 |
Locus ID | 84520 |
Cytogenetics | 14q32.12 |
Summary | Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. GON7 likely plays a supporting role to the catalytic subunit OSGEP in the complex.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410068 | C14orf142 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410068 | Transient overexpression lysate of chromosome 14 open reading frame 142 (C14orf142) |
CNY 3080.00 |
|
TP306178 | Recombinant protein of human chromosome 14 open reading frame 142 (C14orf142), 20 µg |
CNY 2900.00 |
其它C14orf142产品