EGLN2 (NM_053046) Human Mass Spec Standard
CAT#: PH306152
EGLN2 MS Standard C13 and N15-labeled recombinant protein (NP_444274)
View other "EGLN2" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | EGLN2 MS Standard C13 and N15-labeled recombinant protein (NP_444274) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206152 |
| Predicted MW | 43.7 kDa |
| Protein Sequence |
>RC206152 protein sequence
Red=Cloning site Green=Tags(s) MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_444274 |
| RefSeq Size | 2264 |
| RefSeq ORF | 1221 |
| Synonyms | EIT-6; EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1 |
| Locus ID | 112398 |
| Cytogenetics | 19q13.2 |
| Summary | The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene. [provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Pathways in cancer, Renal cell carcinoma |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403281 | EGLN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409048 | EGLN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403281 | Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1 |
CNY 3080.00 |
|
| LY409048 | Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3 |
CNY 3080.00 |
|
| TP306152 | Recombinant protein of human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760370 | Purified recombinant protein of Human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
