Adenylate kinase 5 (AK5) (NM_012093) Human Mass Spec Standard
CAT#: PH306127
AK5 MS Standard C13 and N15-labeled recombinant protein (NP_036225)
View other "Adenylate kinase 5" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | AK5 MS Standard C13 and N15-labeled recombinant protein (NP_036225) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206127 |
| Predicted MW | 60.2 kDa |
| Protein Sequence |
>RC206127 representing NM_012093
Red=Cloning site Green=Tags(s) MCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSRRSFLRNVMPGNSNFPYRRYD RLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGEL LRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICT PDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDE VFYDISMAVDNKLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKC KIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKE AMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAK RLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036225 |
| RefSeq Size | 3937 |
| RefSeq ORF | 1608 |
| Synonyms | AK6 |
| Locus ID | 26289 |
| Cytogenetics | 1p31.1 |
| Summary | This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403569 | AK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415983 | AK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403569 | Transient overexpression lysate of adenylate kinase 5 (AK5), transcript variant 1 |
CNY 3080.00 |
|
| LY415983 | Transient overexpression lysate of adenylate kinase 5 (AK5), transcript variant 2 |
CNY 3080.00 |
|
| PH322241 | AK5 MS Standard C13 and N15-labeled recombinant protein (NP_777283) |
CNY 19520.00 |
|
| TP306127 | Recombinant protein of human adenylate kinase 5 (AK5), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP322241 | Recombinant protein of human adenylate kinase 5 (AK5), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Adenylate kinase 5产品
