SCAP2 (SKAP2) (NM_003930) Human Mass Spec Standard
CAT#: PH306119
SKAP2 MS Standard C13 and N15-labeled recombinant protein (NP_003921)
View other "SCAP2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SKAP2 MS Standard C13 and N15-labeled recombinant protein (NP_003921) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206119 |
Predicted MW | 41.2 kDa |
Protein Sequence |
>RC206119 protein sequence
Red=Cloning site Green=Tags(s) MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAE DGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKR WCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEW VQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQR KMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPK AYIMEMYDI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003921 |
RefSeq Size | 3984 |
RefSeq ORF | 1077 |
Synonyms | PRAP; RA70; SAPS; SCAP2; SKAP-HOM; SKAP55R |
Locus ID | 8935 |
Cytogenetics | 7p15.2 |
Summary | The protein encoded by this gene shares homology with Src kinase-associated phosphoprotein 1, and is a substrate of Src family kinases. It is an adaptor protein that is thought to play an essential role in the Src signaling pathway, and in regulating proper activation of the immune system. This protein contains an amino terminal coiled-coil domain for self-dimerization, a plecskstrin homology (PH) domain required for interactions with lipids at the membrane, and a Src homology (SH3) domain at the carboxy terminus. Some reports indicate that this protein inhibits actin polymerization through interactions with actin assembly factors, and might negatively regulate the invasiveness of tumors by modulating actin assembly. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401289 | SKAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401289 | Transient overexpression lysate of src kinase associated phosphoprotein 2 (SKAP2) |
CNY 3080.00 |
|
TP306119 | Recombinant protein of human src kinase associated phosphoprotein 2 (SKAP2), 20 µg |
CNY 2900.00 |