TPRKB (NM_016058) Human Mass Spec Standard
CAT#: PH306008
TPRKB MS Standard C13 and N15-labeled recombinant protein (NP_057142)
View other "TPRKB" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | TPRKB MS Standard C13 and N15-labeled recombinant protein (NP_057142) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206008 |
| Predicted MW | 19.7 kDa |
| Protein Sequence |
>RC206008 protein sequence
Red=Cloning site Green=Tags(s) MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKM KTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIM NITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057142 |
| RefSeq Size | 752 |
| RefSeq ORF | 525 |
| Synonyms | CGI-121; CGI121; GAMOS5 |
| Locus ID | 51002 |
| Cytogenetics | 2p13.1 |
| Summary | Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:28805828). The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37 (PubMed:22912744, PubMed:28805828). TPRKB acts as an allosteric effector that regulates the t(6)A activity of the complex. TPRKB is not required for tRNA modification (PubMed:22912744, PubMed:28805828).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414223 | TPRKB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414223 | Transient overexpression lysate of TP53RK binding protein (TPRKB) |
CNY 3080.00 |
|
| TP306008 | Recombinant protein of human TP53RK binding protein (TPRKB), 20 µg |
CNY 2900.00 |
