SMRP1 (C9orf24) (NM_032596) Human Mass Spec Standard
CAT#: PH305959
C9orf24 MS Standard C13 and N15-labeled recombinant protein (NP_115985)
View other "SMRP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C9orf24 MS Standard C13 and N15-labeled recombinant protein (NP_115985) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205959 |
Predicted MW | 30.2 kDa |
Protein Sequence |
>RC205959 protein sequence
Red=Cloning site Green=Tags(s) MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHTMERHVDPEALQKMAKCAVQD YTYRGSISGHPYLPEKYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAV RGMPLECPPRPERLNAYEREVMVNMLNSLSRNQQLPRITPRCGCVDPLPGRLPFHGYESACSGRHYCLRG MDYYASGAPCTDRRLRPWCREQQTMCTSLRAPARNAVCCYNSPAVILPISEP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115985 |
RefSeq Size | 1184 |
RefSeq ORF | 786 |
Synonyms | bA573M23.4; CBE1; NYD-SP22; SMRP1 |
Locus ID | 84688 |
Cytogenetics | 9p13.3 |
Summary | This gene encodes a nuclear- or perinuclear-localized protein with no predicted domains or similarity to other known proteins. Expression of this gene is induced during the differentiation of bronchial epithelial cells, and the encoded protein may play a role in ciliogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410011 | C9orf24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410011 | Transient overexpression lysate of chromosome 9 open reading frame 24 (C9orf24), transcript variant 1 |
CNY 3080.00 |
|
TP305959 | Recombinant protein of human chromosome 9 open reading frame 24 (C9orf24), transcript variant 1, 20 µg |
CNY 2900.00 |