ERp57 (PDIA3) (NM_005313) Human Mass Spec Standard
CAT#: PH305940
PDIA3 MS Standard C13 and N15-labeled recombinant protein (NP_005304)
View other "ERp57" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PDIA3 MS Standard C13 and N15-labeled recombinant protein (NP_005304) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205940 |
| Predicted MW | 56.78 kDa |
| Protein Sequence |
>RC205940 representing NM_005313
Red=Cloning site Green=Tags(s) MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAA ATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLR TEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSH LTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWR NRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALE RFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVI QEEKPKKKKKAQEDL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005304 |
| RefSeq Size | 3060 |
| RefSeq ORF | 1515 |
| Synonyms | ER60; ERp57; ERp60; ERp61; GRP57; GRP58; HEL-S-93n; HEL-S-269; HsT17083; P58; PI-PLC |
| Locus ID | 2923 |
| Cytogenetics | 15q15.3 |
| Summary | This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates. This protein also functions as a molecular chaperone that prevents the formation of protein aggregates. [provided by RefSeq, Dec 2016] |
| Protein Families | Druggable Genome |
| Protein Pathways | Antigen processing and presentation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401637 | PDIA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401637 | Transient overexpression lysate of protein disulfide isomerase family A, member 3 (PDIA3) |
CNY 3080.00 |
|
| TP305940 | Recombinant protein of human protein disulfide isomerase family A, member 3 (PDIA3), 20 µg |
CNY 2900.00 |
|
| TP721117 | Purified recombinant protein of Human protein disulfide isomerase family A, member 3 (PDIA3 |
CNY 1800.00 |
