GNGT1 (NM_021955) Human Mass Spec Standard
CAT#: PH305899
GNGT1 MS Standard C13 and N15-labeled recombinant protein (NP_068774)
View other "GNGT1" proteins (1)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GNGT1 MS Standard C13 and N15-labeled recombinant protein (NP_068774) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205899 |
| Predicted MW | 8.5 kDa |
| Protein Sequence |
>RC205899 protein sequence
Red=Cloning site Green=Tags(s) MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGG CVIS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_068774 |
| RefSeq Size | 628 |
| RefSeq ORF | 222 |
| Synonyms | GNG1 |
| Locus ID | 2792 |
| Cytogenetics | 7q21.3 |
| Summary | This gene encodes the gamma subunit of transducin, a guanine nucleotide-binding protein (G protein) that is found in rod outer segments. Transducin, also known as GMPase, mediates the activation of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase by rhodopsin. [provided by RefSeq, Jul 2016] |
| Protein Families | Druggable Genome |
| Protein Pathways | Chemokine signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP305899 | Recombinant protein of human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), 20 µg |
CNY 2900.00 |


