CSHL1 (NM_001318) Human Mass Spec Standard
CAT#: PH305897
CSHL1 MS Standard C13 and N15-labeled recombinant protein (NP_001309)
View other "CSHL1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CSHL1 MS Standard C13 and N15-labeled recombinant protein (NP_001309) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205897 |
| Predicted MW | 14.9 kDa |
| Protein Sequence |
>RC205897 protein sequence
Red=Cloning site Green=Tags(s) MEETQQKSNLELLHISLLLIESRLEPVRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSH LTGQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001309 |
| RefSeq Size | 661 |
| RefSeq ORF | 384 |
| Synonyms | CS-5; CSHP1; CSL; GHB4; hCS-L |
| Locus ID | 1444 |
| Cytogenetics | 17q23.3 |
| Summary | The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. This particular family member is expressed in placental villi, although it was originally thought to be a pseudogene. In fact, alternative splicing suggests that the majority of the transcripts would be unable to express a secreted protein. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411613 | CSHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420013 | CSHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411613 | Transient overexpression lysate of chorionic somatomammotropin hormone-like 1 (CSHL1), transcript variant 4 |
CNY 3080.00 |
|
| LY420013 | Transient overexpression lysate of chorionic somatomammotropin hormone-like 1 (CSHL1), transcript variant 3 |
CNY 3080.00 |
|
| TP305897 | Recombinant protein of human chorionic somatomammotropin hormone-like 1 (CSHL1), transcript variant 3, 20 µg |
CNY 2900.00 |
