splicing factor 1 (SF1) (NM_201998) Human Mass Spec Standard
CAT#: PH305846
SF1 MS Standard C13 and N15-labeled recombinant protein (NP_973727)
View other "splicing factor 1" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
Product Data | |
Description | SF1 MS Standard C13 and N15-labeled recombinant protein (NP_973727) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205846 |
Predicted MW | 59.7 kDa |
Protein Sequence |
>RC205846 protein sequence
Red=Cloning site Green=Tags(s) MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDL GIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKV MIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTAN TMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCT KCGGAGHIASDCKFQRPGDPQSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPA NNPPPPSLMSTTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGP PPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPP PPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQRSLPAAAMARAMRVRTFRAHW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_973727 |
RefSeq Size | 2949 |
RefSeq ORF | 1644 |
Synonyms | BBP; D11S636; MBBP; ZCCHC25; ZFM1; ZNF162 |
Locus ID | 7536 |
Cytogenetics | 11q13.1 |
Summary | This gene encodes a nuclear pre-mRNA splicing factor. The encoded protein specifically recognizes the intron branch point sequence at the 3' splice site, together with the large subunit of U2 auxiliary factor (U2AF), and is required for the early stages of spliceosome assembly. It also plays a role in nuclear pre-mRNA retention and transcriptional repression. The encoded protein contains an N-terminal U2AF ligand motif, a central hnRNP K homology motif and quaking 2 region which bind a key branch-site adenosine within the branch point sequence, a zinc knuckles domain, and a C-terminal proline-rich domain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404503 | SF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC404504 | SF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404505 | SF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417858 | SF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY404503 | Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 2 |
CNY 4840.00 |
|
LY404504 | Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 4 |
CNY 3080.00 |
|
LY404505 | Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 3 |
CNY 3080.00 |
|
LY417858 | Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 1 |
CNY 4840.00 |
|
TP305846 | Recombinant protein of human splicing factor 1 (SF1), transcript variant 3, 20 µg |
CNY 2900.00 |
其它splicing factor 1产品