LSM7 (NM_016199) Human Mass Spec Standard
CAT#: PH305835
LSM7 MS Standard C13 and N15-labeled recombinant protein (NP_057283)
View other "LSM7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | LSM7 MS Standard C13 and N15-labeled recombinant protein (NP_057283) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205835 |
| Predicted MW | 11.6 kDa |
| Protein Sequence |
>RC205835 protein sequence
Red=Cloning site Green=Tags(s) MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQ LGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057283 |
| RefSeq Size | 536 |
| RefSeq ORF | 309 |
| Synonyms | YNL147W |
| Locus ID | 51690 |
| Cytogenetics | 19p13.3 |
| Summary | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Apr 2004] |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | RNA degradation, Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414131 | LSM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414131 | Transient overexpression lysate of LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM7) |
CNY 3080.00 |
|
| TP305835 | Recombinant protein of human LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM7), 20 µg |
CNY 2900.00 |
