ST3GAL6 (NM_006100) Human Mass Spec Standard
CAT#: PH305750
ST3GAL6 MS Standard C13 and N15-labeled recombinant protein (NP_006091)
View other "ST3GAL6" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | ST3GAL6 MS Standard C13 and N15-labeled recombinant protein (NP_006091) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC205750 | 
| Predicted MW | 38.2 kDa | 
| Protein Sequence | 
                 >RC205750 protein sequence 
Red=Cloning site Green=Tags(s) MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFR KIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYD VIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNG FWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFK YNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_006091 | 
| RefSeq Size | 3571 | 
| RefSeq ORF | 993 | 
| Synonyms | SIAT10; ST3GALVI | 
| Locus ID | 10402 | 
| Cytogenetics | 3q12.1 | 
| Summary | The protein encoded by this gene is a member of the sialyltransferase family. Members of this family are enzymes that transfer sialic acid from the activated cytidine 5'-monophospho-N-acetylneuraminic acid to terminal positions on sialylated glycolipids (gangliosides) or to the N- or O-linked sugar chains of glycoproteins. This protein has high specificity for neolactotetraosylceramide and neolactohexaosylceramide as glycolipid substrates and may contribute to the formation of selectin ligands and sialyl Lewis X, a carbohydrate important for cell-to-cell recognition and a blood group antigen. [provided by RefSeq, Apr 2016] | 
| Protein Families | Transmembrane | 
| Protein Pathways | Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC416864 | ST3GAL6 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY416864 | Transient overexpression lysate of ST3 beta-galactoside alpha-2,3-sialyltransferase 6 (ST3GAL6) | 
                                                     CNY 3080.00  | 
                                            |
| TP305750 | Recombinant protein of human ST3 beta-galactoside alpha-2,3-sialyltransferase 6 (ST3GAL6), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它ST3GAL6产品
