DR1 (NM_001938) Human Mass Spec Standard
CAT#: PH305733
DR1 MS Standard C13 and N15-labeled recombinant protein (NP_001929)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DR1 MS Standard C13 and N15-labeled recombinant protein (NP_001929) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205733 |
Predicted MW | 19.4 kDa |
Protein Sequence |
>RC205733 protein sequence
Red=Cloning site Green=Tags(s) MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEH VIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQE WLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001929 |
RefSeq Size | 3222 |
RefSeq ORF | 528 |
Synonyms | NC2; NC2-BETA; NC2B; NCB2 |
Locus ID | 1810 |
Cytogenetics | 1p22.1 |
Summary | This gene encodes a TBP- (TATA box-binding protein) associated phosphoprotein that represses both basal and activated levels of transcription. The encoded protein is phosphorylated in vivo and this phosphorylation affects its interaction with TBP. This protein contains a histone fold motif at the amino terminus, a TBP-binding domain, and a glutamine- and alanine-rich region. The binding of DR1 repressor complexes to TBP-promoter complexes may establish a mechanism in which an altered DNA conformation, together with the formation of higher order complexes, inhibits the assembly of the preinitiation complex and controls the rate of RNA polymerase II transcription. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419640 | DR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419640 | Transient overexpression lysate of down-regulator of transcription 1, TBP-binding (negative cofactor 2) (DR1) |
CNY 3080.00 |
|
TP305733 | Recombinant protein of human down-regulator of transcription 1, TBP-binding (negative cofactor 2) (DR1), 20 µg |
CNY 2900.00 |