Kindlin 2 (FERMT2) (NM_006832) Human Mass Spec Standard
CAT#: PH305727
FERMT2 MS Standard C13 and N15-labeled recombinant protein (NP_006823)
View other "Kindlin 2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | FERMT2 MS Standard C13 and N15-labeled recombinant protein (NP_006823) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205727 |
| Predicted MW | 77.9 kDa |
| Protein Sequence |
>RC205727 protein sequence
Red=Cloning site Green=Tags(s) MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRT WLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL LKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGD SALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFF DLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAAL SDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQ NILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQ AWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFAD EVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006823 |
| RefSeq Size | 3351 |
| RefSeq ORF | 2040 |
| Synonyms | KIND2; mig-2; MIG2; PLEKHC1; UNC112; UNC112B |
| Locus ID | 10979 |
| Cytogenetics | 14q22.1 |
| Summary | Scaffolding protein that enhances integrin activation mediated by TLN1 and/or TLN2, but activates integrins only weakly by itself. Binds to membranes enriched in phosphoinositides. Enhances integrin-mediated cell adhesion onto the extracellular matrix and cell spreading; this requires both its ability to interact with integrins and with phospholipid membranes. Required for the assembly of focal adhesions. Participates in the connection between extracellular matrix adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. Recruits FBLIM1 to focal adhesions. Plays a role in the TGFB1 and integrin signaling pathways. Stabilizes active CTNNB1 and plays a role in the regulation of transcription mediated by CTNNB1 and TCF7L2/TCF4 and in Wnt signaling.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416377 | FERMT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427519 | FERMT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY416377 | Transient overexpression lysate of fermitin family homolog 2 (Drosophila) (FERMT2), transcript variant 1 |
CNY 3080.00 |
|
| LY427519 | Transient overexpression lysate of fermitin family homolog 2 (Drosophila) (FERMT2), transcript variant 2 |
CNY 4840.00 |
|
| TP305727 | Recombinant protein of human fermitin family homolog 2 (Drosophila) (FERMT2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Kindlin 2产品
