RRM2 (NM_001034) Human Mass Spec Standard
CAT#: PH305718
RRM2 MS Standard C13 and N15-labeled recombinant protein (NP_001025)
View other "RRM2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | RRM2 MS Standard C13 and N15-labeled recombinant protein (NP_001025) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205718 |
| Predicted MW | 44.7 kDa |
| Protein Sequence |
>RC205718 representing NM_001034
Red=Cloning site Green=Tags(s) MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE PLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGI VNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWA LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL VHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001025 |
| RefSeq Size | 2500 |
| RefSeq ORF | 1167 |
| Synonyms | C2orf48; R2; RR2; RR2M |
| Locus ID | 6241 |
| Cytogenetics | 2p25.1 |
| Summary | This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Sep 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421950 | RRM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431390 | RRM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421950 | Transient overexpression lysate of ribonucleotide reductase M2 (RRM2), transcript variant 2 |
CNY 3080.00 |
|
| LY431390 | Transient overexpression lysate of ribonucleotide reductase M2 (RRM2), transcript variant 1 |
CNY 3080.00 |
|
| TP305718 | Recombinant protein of human ribonucleotide reductase M2 polypeptide (RRM2), 20 µg |
CNY 2900.00 |


