C9orf23 (RPP25L) (NM_148178) Human Mass Spec Standard
CAT#: PH305700
C9orf23 MS Standard C13 and N15-labeled recombinant protein (NP_680544)
View other "C9orf23" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C9orf23 MS Standard C13 and N15-labeled recombinant protein (NP_680544) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205700 |
Predicted MW | 17.6 kDa |
Protein Sequence |
>RC205700 protein sequence
Red=Cloning site Green=Tags(s) MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSC AEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPP GLGSMPSSSCGPRSRRRARDTRS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_680544 |
RefSeq Size | 915 |
RefSeq ORF | 489 |
Synonyms | bA296L22.5; C9orf23 |
Locus ID | 138716 |
Cytogenetics | 9p13.3 |
Summary | This gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407738 | RPP25L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407739 | RPP25L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407738 | Transient overexpression lysate of chromosome 9 open reading frame 23 (C9orf23), transcript variant 1 |
CNY 3080.00 |
|
LY407739 | Transient overexpression lysate of chromosome 9 open reading frame 23 (C9orf23), transcript variant 2 |
CNY 3080.00 |
|
PH323396 | C9orf23 MS Standard C13 and N15-labeled recombinant protein (NP_680545) |
CNY 19520.00 |
|
TP305700 | Recombinant protein of human chromosome 9 open reading frame 23 (C9orf23), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP323396 | Recombinant protein of human chromosome 9 open reading frame 23 (C9orf23), transcript variant 2, 20 µg |
CNY 2900.00 |
其它C9orf23产品