Rab9 (RAB9A) (NM_004251) Human Mass Spec Standard
CAT#: PH305698
RAB9A MS Standard C13 and N15-labeled recombinant protein (NP_004242)
View other "Rab9" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RAB9A MS Standard C13 and N15-labeled recombinant protein (NP_004242) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205698 |
| Predicted MW | 22.8 kDa |
| Protein Sequence |
>RC205698 protein sequence
Red=Cloning site Green=Tags(s) MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFR SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQA WCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSCC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004242 |
| RefSeq Size | 1377 |
| RefSeq ORF | 603 |
| Synonyms | RAB9 |
| Locus ID | 9367 |
| Cytogenetics | Xp22.2 |
| Summary | Involved in the transport of proteins between the endosomes and the trans Golgi network. Involved in the recruitment of SGSM2 to melanosomes and is required for the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401363 | RAB9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401363 | Transient overexpression lysate of RAB9A, member RAS oncogene family (RAB9A) |
CNY 3080.00 |
|
| TP305698 | Recombinant protein of human RAB9A, member RAS oncogene family (RAB9A), 20 µg |
CNY 2900.00 |
