PXR (NR1I2) (NM_003889) Human Mass Spec Standard
CAT#: PH305691
NR1I2 MS Standard C13 and N15-labeled recombinant protein (NP_003880)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NR1I2 MS Standard C13 and N15-labeled recombinant protein (NP_003880) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205691 |
| Predicted MW | 49.6 kDa |
| Protein Sequence |
>RC205691 representing NM_003889
Red=Cloning site Green=Tags(s) AIAXEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRR AMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQP LGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCS LKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKG AAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISL FSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIH PFATPLMQELFGITGS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003880 |
| RefSeq Size | 4446 |
| RefSeq ORF | 1299 |
| Synonyms | BXR; ONR1; PAR; PAR1; PAR2; PARq; PRR; PXR; SAR; SXR |
| Locus ID | 8856 |
| Cytogenetics | 3q13.33 |
| Summary | This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401282 | NR1I2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401282 | Transient overexpression lysate of nuclear receptor subfamily 1, group I, member 2 (NR1I2), transcript variant 1 |
CNY 3080.00 |
|
| TP305691 | Recombinant protein of human nuclear receptor subfamily 1, group I, member 2 (NR1I2), transcript variant 1, 20 µg |
CNY 2900.00 |
