SPDEF (NM_012391) Human Mass Spec Standard
CAT#: PH305688
SPDEF MS Standard C13 and N15-labeled recombinant protein (NP_036523)
View other "SPDEF" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SPDEF MS Standard C13 and N15-labeled recombinant protein (NP_036523) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205688 |
| Predicted MW | 37.5 kDa |
| Protein Sequence |
>RC205688 protein sequence
Red=Cloning site Green=Tags(s) MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPED SSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKL LNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWK SAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFK IEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036523 |
| RefSeq Size | 1914 |
| RefSeq ORF | 1005 |
| Synonyms | bA375E1.3; PDEF |
| Locus ID | 25803 |
| Cytogenetics | 6p21.31 |
| Summary | The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415796 | SPDEF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415796 | Transient overexpression lysate of SAM pointed domain containing ets transcription factor (SPDEF) |
CNY 3080.00 |
|
| TP305688 | Recombinant protein of human SAM pointed domain containing ets transcription factor (SPDEF), 20 µg |
CNY 2900.00 |
