SPR (NM_003124) Human Mass Spec Standard
CAT#: PH305679
SPR MS Standard C13 and N15-labeled recombinant protein (NP_003115)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SPR MS Standard C13 and N15-labeled recombinant protein (NP_003115) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205679 |
| Predicted MW | 28 kDa |
| Protein Sequence |
>RC205679 protein sequence
Red=Cloning site Green=Tags(s) MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADL GAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLK AFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLAR ETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003115 |
| RefSeq Size | 1466 |
| RefSeq ORF | 783 |
| Synonyms | SDR38C1 |
| Locus ID | 6697 |
| Cytogenetics | 2p13.2 |
| Summary | This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Folate biosynthesis, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401086 | SPR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401086 | Transient overexpression lysate of sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) (SPR) |
CNY 3080.00 |
|
| TP305679 | Recombinant protein of human sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) (SPR), 20 µg |
CNY 2900.00 |

