Neurokinin B (TAC3) (NM_013251) Human Mass Spec Standard
CAT#: PH305666
TAC3 MS Standard C13 and N15-labeled recombinant protein (NP_037383)
View other "Neurokinin B" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TAC3 MS Standard C13 and N15-labeled recombinant protein (NP_037383) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205666 |
| Predicted MW | 13.4 kDa |
| Protein Sequence |
>RC205666 protein sequence
Red=Cloning site Green=Tags(s) MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTD PKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_037383 |
| RefSeq Size | 841 |
| RefSeq ORF | 363 |
| Synonyms | HH10; LncZBTB39; NK3; NKB; NKNB; PRO1155; ZNEUROK1 |
| Locus ID | 6866 |
| Cytogenetics | 12q13.3 |
| Summary | This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded preproprotein is proteolytically processed to generate the mature peptide, which is primarily expressed in the central and peripheral nervous systems and functions as a neurotransmitter. This peptide is the ligand for the neurokinin-3 receptor. This protein is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. Mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415710 | TAC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415710 | Transient overexpression lysate of tachykinin 3 (TAC3) |
CNY 3080.00 |
|
| TP305666 | Recombinant protein of human tachykinin 3 (TAC3), 20 µg |
CNY 2900.00 |
|
| TP720967 | Purified recombinant protein of Human tachykinin 3 (TAC3), transcript variant 1 |
CNY 1800.00 |
其它Neurokinin B产品
