CYRIB (NM_016623) Human Mass Spec Standard
CAT#: PH305660
FAM49B MS Standard C13 and N15-labeled recombinant protein (NP_057707)
View other "CYRIB" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FAM49B MS Standard C13 and N15-labeled recombinant protein (NP_057707) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205660 |
Predicted MW | 36.7 kDa |
Protein Sequence |
>RC205660 protein sequence
Red=Cloning site Green=Tags(s) MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHP ADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQHLEREQALAKQFAEILHFTL RFDELKMTNPAIQNDFSYYRRTLSRMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVS ENKNLPIENTTDCLSTMASVCRVMLETPEYRSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKID MKGCIKVLKDQPPNSVEGLLNALRYTTKHLNDETTSKQIKSMLQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057707 |
RefSeq Size | 3838 |
RefSeq ORF | 972 |
Synonyms | BM-009; CYRI; CYRI-B; FAM49B; L1 |
Locus ID | 51571 |
Cytogenetics | 8q24.21 |
Summary | Negatively regulates RAC1 signaling and RAC1-driven cytoskeletal remodeling (PubMed:31285585, PubMed:30250061). Regulates chemotaxis, cell migration and epithelial polarization by controlling the polarity, plasticity, duration and extent of protrusions. Limits Rac1 mediated activation of the Scar/WAVE complex, focuses protrusion signals and regulates pseudopod complexity by inhibiting Scar/WAVE-induced actin polymerization (PubMed:30250061). Protects against Salmonella bacterial infection. Attenuates processes such as macropinocytosis, phagocytosis and cell migration and restrict sopE-mediated bacterial entry (PubMed:31285585). Restricts also infection mediated by Mycobacterium tuberculosis and Listeria monocytogenes (By similarity). Involved in the regulation of mitochondrial dynamics and oxidative stress (PubMed:29059164).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413876 | FAM49B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413876 | Transient overexpression lysate of family with sequence similarity 49, member B (FAM49B) |
CNY 3080.00 |
|
TP305660 | Recombinant protein of human family with sequence similarity 49, member B (FAM49B), 20 µg |
CNY 2900.00 |