RND1 (NM_014470) Human Mass Spec Standard
CAT#: PH305535
RND1 MS Standard C13 and N15-labeled recombinant protein (NP_055285)
View other "RND1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | RND1 MS Standard C13 and N15-labeled recombinant protein (NP_055285) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205535 |
| Predicted MW | 26.1 kDa |
| Protein Sequence |
>RC205535 protein sequence
Red=Cloning site Green=Tags(s) MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSG SPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELS HQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHL PSRSELISSTFKKEKAKSCSIM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055285 |
| RefSeq Size | 1665 |
| RefSeq ORF | 696 |
| Synonyms | ARHS; RHO6; RHOS |
| Locus ID | 27289 |
| Cytogenetics | 12q13.12 |
| Summary | This gene encodes a protein that belongs to the Rho GTPase family. Members of this family regulate the organization of the actin cytoskeleton in response to extracellular growth factors. A similar protein in rat interacts with a microtubule regulator to control axon extension. [provided by RefSeq, Apr 2014] |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | Axon guidance |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415252 | RND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415252 | Transient overexpression lysate of Rho family GTPase 1 (RND1) |
CNY 3080.00 |
|
| TP305535 | Recombinant protein of human Rho family GTPase 1 (RND1), 20 µg |
CNY 2900.00 |
