TSACC (NM_144627) Human Mass Spec Standard
CAT#: PH305523
C1orf182 MS Standard C13 and N15-labeled recombinant protein (NP_653228)
View other "TSACC" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | C1orf182 MS Standard C13 and N15-labeled recombinant protein (NP_653228) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205523 |
| Predicted MW | 13.7 kDa |
| Protein Sequence |
>RC205523 protein sequence
Red=Cloning site Green=Tags(s) MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLGLLECMY ANLQLQTQLAQQQMAVLEHLQASVTQLAPGRGSNNSSLPALSPNPLLNHLPQFSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_653228 |
| RefSeq Size | 764 |
| RefSeq ORF | 375 |
| Synonyms | C1orf182; SIP; SSTK-IP |
| Locus ID | 128229 |
| Cytogenetics | 1q22 |
| Summary | Co-chaperone that facilitates HSP-mediated activation of TSSK6.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408258 | TSACC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408258 | Transient overexpression lysate of chromosome 1 open reading frame 182 (C1orf182) |
CNY 3080.00 |
|
| TP305523 | Recombinant protein of human chromosome 1 open reading frame 182 (C1orf182), 20 µg |
CNY 2900.00 |
