RBJ (DNAJC27) (NM_016544) Human Mass Spec Standard
CAT#: PH305500
DNAJC27 MS Standard C13 and N15-labeled recombinant protein (NP_057628)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | DNAJC27 MS Standard C13 and N15-labeled recombinant protein (NP_057628) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205500 |
Predicted MW | 30.9 kDa |
Protein Sequence |
>RC205500 protein sequence
Red=Cloning site Green=Tags(s) MEANMPKRKEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIF DMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTK HRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKRPTTNSSASFTKEQADAIR RIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057628 |
RefSeq Size | 5008 |
RefSeq ORF | 819 |
Synonyms | RabJS; RBJ |
Locus ID | 51277 |
Cytogenetics | 2p23.3 |
Summary | GTPase which can activate the MEK/ERK pathway and induce cell transformation when overexpressed. May act as a nuclear scaffold for MAPK1, probably by association with MAPK1 nuclear export signal leading to enhanced ERK1/ERK2 signaling.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413917 | DNAJC27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434021 | DNAJC27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413917 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27) |
CNY 3080.00 |
|
LY434021 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27), transcript variant 2 |
CNY 3080.00 |
|
TP305500 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27), 20 µg |
CNY 2900.00 |