Non Neuronal Enolase (ENO1) (NM_001428) Human Mass Spec Standard
CAT#: PH305494
ENO1 MS Standard C13 and N15-labeled recombinant protein (NP_001419)
View other "Non Neuronal Enolase" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ENO1 MS Standard C13 and N15-labeled recombinant protein (NP_001419) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205494 |
| Predicted MW | 47.2 kDa |
| Protein Sequence |
>RC205494 protein sequence
Red=Cloning site Green=Tags(s) MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHIN KTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGN SEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDE GGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLY KSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK AKFAGRNFRNPLAK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001419 |
| RefSeq Size | 2204 |
| RefSeq ORF | 1302 |
| Synonyms | ENO1L1; HEL-S-17; MPB1; NNE; PPH |
| Locus ID | 2023 |
| Cytogenetics | 1p36.23 |
| Summary | This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy. [provided by RefSeq, Jan 2011] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400561 | ENO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400561 | Transient overexpression lysate of enolase 1, (alpha) (ENO1) |
CNY 3080.00 |
|
| TP305494 | Recombinant protein of human enolase 1, (alpha) (ENO1), 20 µg |
CNY 2900.00 |
|
| TP762494 | Purified recombinant protein of Human enolase 1, (alpha) (ENO1), transcript variant 1, 1Met-421Ala, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2150.00 |
其它Non Neuronal Enolase产品

