Neuronal membrane glycoprotein M6 a (GPM6A) (NM_005277) Human Mass Spec Standard
CAT#: PH305432
GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_005268)
View other "Neuronal membrane glycoprotein M6 a" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_005268) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205432 |
| Predicted MW | 31.2 kDa |
| Protein Sequence |
>RC205432 protein sequence
Red=Cloning site Green=Tags(s) MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQTYFEMARTAGD TLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLA WLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELNMT FHLFIVALAGAGAAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005268 |
| RefSeq Size | 3215 |
| RefSeq ORF | 834 |
| Synonyms | GPM6; M6A |
| Locus ID | 2823 |
| Cytogenetics | 4q34.2 |
| Summary | Involved in neuronal differentiation, including differentiation and migration of neuronal stem cells. Plays a role in neuronal plasticity and is involved in neurite and filopodia outgrowth, filopodia motility and probably synapse formation. GPM6A-induced filopodia formation involves mitogen-activated protein kinase (MAPK) and Src signaling pathways. May be involved in neuronal NGF-dependent Ca(2+) influx. May be involved in regulation of endocytosis and intracellular trafficking of G-protein-coupled receptors (GPCRs); enhances internalization and recycling of mu-type opioid receptor.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401623 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404475 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404476 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401623 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 1 |
CNY 3080.00 |
|
| LY404475 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 2 |
CNY 3080.00 |
|
| LY404476 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 3 |
CNY 3080.00 |
|
| PH305371 | GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963885) |
CNY 19520.00 |
|
| PH313529 | GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963886) |
CNY 19520.00 |
|
| TP305371 | Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP305432 | Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP313529 | Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 3, 20 µg |
CNY 2900.00 |
其它Neuronal membrane glycoprotein M6 a产品
