CAPSL (NM_001042625) Human Mass Spec Standard
CAT#: PH305410
CAPSL MS Standard C13 and N15-labeled recombinant protein (NP_001036090)
View other "CAPSL" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | CAPSL MS Standard C13 and N15-labeled recombinant protein (NP_001036090) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205410 |
| Predicted MW | 23.1 kDa |
| Protein Sequence |
>RC205410 protein sequence
Red=Cloning site Green=Tags(s) MAIQAKKKLTTATNPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEV EELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQN GEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001036090 |
| RefSeq Size | 987 |
| RefSeq ORF | 594 |
| Locus ID | 133690 |
| Cytogenetics | 5p13.2 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408188 | CAPSL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421009 | CAPSL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408188 | Transient overexpression lysate of calcyphosine-like (CAPSL), transcript variant 1 |
CNY 3080.00 |
|
| LY421009 | Transient overexpression lysate of calcyphosine-like (CAPSL), transcript variant 2 |
CNY 3080.00 |
|
| PH311974 | CAPSL MS Standard C13 and N15-labeled recombinant protein (NP_653248) |
CNY 19520.00 |
|
| TP305410 | Recombinant protein of human calcyphosine-like (CAPSL), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP311974 | Recombinant protein of human calcyphosine-like (CAPSL), transcript variant 1, 20 µg |
CNY 2900.00 |
