Calreticulin 3 (CALR3) (NM_145046) Human Mass Spec Standard
CAT#: PH305398
CALR3 MS Standard C13 and N15-labeled recombinant protein (NP_659483)
View other "Calreticulin 3" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CALR3 MS Standard C13 and N15-labeled recombinant protein (NP_659483) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205398 |
| Predicted MW | 45 kDa |
| Protein Sequence |
>RC205398 protein sequence
Red=Cloning site Green=Tags(s) MARALVQFWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQ NGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFD IKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETS PAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKM KNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKE EMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_659483 |
| RefSeq Size | 1295 |
| RefSeq ORF | 1152 |
| Synonyms | CMH19; CRT2; CT93 |
| Locus ID | 125972 |
| Cytogenetics | 19p13.11 |
| Summary | The protein encoded by this gene belongs to the calreticulin family, members of which are calcium-binding chaperones localized mainly in the endoplasmic reticulum. This protein is also localized to the endoplasmic reticulum lumen, however, its capacity for calcium-binding may be absent or much lower than other family members. This gene is specifically expressed in the testis, and may be required for sperm fertility. Mutation in this gene has been associated with familial hypertrophic cardiomyopathy. [provided by RefSeq, Dec 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403418 | CALR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403418 | Transient overexpression lysate of calreticulin 3 (CALR3) |
CNY 3080.00 |
|
| TP305398 | Recombinant protein of human calreticulin 3 (CALR3), 20 µg |
CNY 2900.00 |
|
| TP721001 | Purified recombinant protein of Human calreticulin 3 (CALR3) |
CNY 1800.00 |
其它Calreticulin 3产品
