GAPDHS (NM_014364) Human Mass Spec Standard
CAT#: PH305362
GAPDHS MS Standard C13 and N15-labeled recombinant protein (NP_055179)
View other "GAPDHS" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | GAPDHS MS Standard C13 and N15-labeled recombinant protein (NP_055179) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205362 |
| Predicted MW | 44.5 kDa |
| Protein Sequence |
>RC205362 protein sequence
Red=Cloning site Green=Tags(s) MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREEIKPPPPPLPPHPATPPPKMV SVARELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVV DNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVISAPSPDAPMFVMGVNEND YNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIP ASTGAAKAVTKVIPELKGKLTGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTE DEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055179 |
| RefSeq Size | 1492 |
| RefSeq ORF | 1224 |
| Synonyms | GAPD2; GAPDH-2; GAPDS; HEL-S-278; HSD-35 |
| Locus ID | 26330 |
| Cytogenetics | 19q13.12 |
| Summary | This gene encodes a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism. Like its somatic cell counterpart, this sperm-specific enzyme functions in a nicotinamide adenine dinucleotide-dependent manner to remove hydrogen and add phosphate to glyceraldehyde 3-phosphate to form 1,3-diphosphoglycerate. During spermiogenesis, this enzyme may play an important role in regulating the switch between different energy-producing pathways, and it is required for sperm motility and male fertility. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402320 | GAPDHS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402320 | Transient overexpression lysate of glyceraldehyde-3-phosphate dehydrogenase, spermatogenic (GAPDHS) |
CNY 3080.00 |
|
| TP305362 | Recombinant protein of human glyceraldehyde-3-phosphate dehydrogenase, spermatogenic (GAPDHS), 20 µg |
CNY 2900.00 |
