VPS26 (VPS26A) (NM_004896) Human Mass Spec Standard
CAT#: PH305353
VPS26A MS Standard C13 and N15-labeled recombinant protein (NP_004887)
View other "VPS26" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | VPS26A MS Standard C13 and N15-labeled recombinant protein (NP_004887) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205353 |
Predicted MW | 38.2 kDa |
Protein Sequence |
>RC205353 protein sequence
Red=Cloning site Green=Tags(s) MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRI EFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRL TDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQ LIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVD EEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004887 |
RefSeq Size | 2707 |
RefSeq ORF | 981 |
Synonyms | HB58; Hbeta58; PEP8A; VPS26 |
Locus ID | 9559 |
Cytogenetics | 10q22.1 |
Summary | This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401527 | VPS26A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422131 | VPS26A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401527 | Transient overexpression lysate of vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 1 |
CNY 3080.00 |
|
LY422131 | Transient overexpression lysate of vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 2 |
CNY 3080.00 |
|
TP305353 | Recombinant protein of human vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 1, 20 µg |
CNY 2900.00 |