DAZL (NM_001351) Human Mass Spec Standard
CAT#: PH305328
DAZL MS Standard C13 and N15-labeled recombinant protein (NP_001342)
View other "DAZL" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DAZL MS Standard C13 and N15-labeled recombinant protein (NP_001342) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205328 |
| Predicted MW | 33 kDa |
| Protein Sequence |
>RC205328 representing NM_001351
Red=Cloning site Green=Tags(s) MSTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVK IITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQ NVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYS AVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDK RVHHFRRSRAMLKSV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001342 |
| RefSeq Size | 3056 |
| RefSeq ORF | 885 |
| Synonyms | DAZH; DAZL1; DAZLA; SPGYLA |
| Locus ID | 1618 |
| Cytogenetics | 3p24.3 |
| Summary | The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400541 | DAZL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434157 | DAZL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400541 | Transient overexpression lysate of deleted in azoospermia-like (DAZL) |
CNY 3080.00 |
|
| LY434157 | Transient overexpression lysate of deleted in azoospermia-like (DAZL), transcript variant 1 |
CNY 3080.00 |
|
| TP305328 | Recombinant protein of human deleted in azoospermia-like (DAZL), 20 µg |
CNY 2900.00 |
