Protein phosphatase inhibitor 1 (PPP1R1A) (NM_006741) Human Mass Spec Standard
CAT#: PH305263
PPP1R1A MS Standard C13 and N15-labeled recombinant protein (NP_006732)
View other "Protein phosphatase inhibitor 1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PPP1R1A MS Standard C13 and N15-labeled recombinant protein (NP_006732) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205263 |
Predicted MW | 18.9 kDa |
Protein Sequence |
>RC205263 protein sequence
Red=Cloning site Green=Tags(s) MEQDNSPQKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHLKSTLAMSPRQ RKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQESRPPGIPDTEVESRLGTSGTAKKTAECI PKTHERGSKEPSTKEPSTHIPPLDSKGANSV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006732 |
RefSeq Size | 1849 |
RefSeq ORF | 513 |
Synonyms | I1; IPP1 |
Locus ID | 5502 |
Cytogenetics | 12q13.2 |
Summary | Inhibitor of protein-phosphatase 1. This protein may be important in hormonal control of glycogen metabolism. Hormones that elevate intracellular cAMP increase I-1 activity in many tissues. I-1 activation may impose cAMP control over proteins that are not directly phosphorylated by PKA. Following a rise in intracellular calcium, I-1 is inactivated by calcineurin (or PP2B). Does not inhibit type-2 phosphatases.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Long-term potentiation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402013 | PPP1R1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402013 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1A (PPP1R1A) |
CNY 3,080.00 |
|
TP305263 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1A (PPP1R1A), 20 µg |
CNY 2,900.00 |
|
TP720141 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1A (PPP1R1A) |
CNY 3,140.00 |
其它Protein phosphatase inhibitor 1产品