WIF1 (NM_007191) Human Mass Spec Standard
CAT#: PH305256
WIF1 MS Standard C13 and N15-labeled recombinant protein (NP_009122)
View other "WIF1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | WIF1 MS Standard C13 and N15-labeled recombinant protein (NP_009122) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205256 |
| Predicted MW | 41.5 kDa |
| Protein Sequence |
>RC205256 protein sequence
Red=Cloning site Green=Tags(s) MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDF RKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPC LGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCE KALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQ PCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALR PAGAQLRQHTPSLKKAEERRDPPESNYIW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009122 |
| RefSeq Size | 2240 |
| RefSeq ORF | 1137 |
| Synonyms | WIF-1 |
| Locus ID | 11197 |
| Cytogenetics | 12q14.3 |
| Summary | The protein encoded by this gene functions to inhibit WNT proteins, which are extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation. This gene functions as a tumor suppressor gene, and has been found to be epigenetically silenced in various cancers. [provided by RefSeq, Jun 2010] |
| Protein Families | Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway |
| Protein Pathways | Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402102 | WIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402102 | Transient overexpression lysate of WNT inhibitory factor 1 (WIF1) |
CNY 3080.00 |
|
| TP305256 | Recombinant protein of human WNT inhibitory factor 1 (WIF1), 20 µg |
CNY 2900.00 |
|
| TP720656 | Purified recombinant protein of Human WNT inhibitory factor 1 (WIF1) |
CNY 1800.00 |

