HPCAL4 (NM_016257) Human Mass Spec Standard
CAT#: PH305253
HPCAL4 MS Standard C13 and N15-labeled recombinant protein (NP_057341)
View other "HPCAL4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | HPCAL4 MS Standard C13 and N15-labeled recombinant protein (NP_057341) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205253 |
| Predicted MW | 22.2 kDa |
| Protein Sequence |
>RC205253 protein sequence
Red=Cloning site Green=Tags(s) MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFR TFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRM NQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057341 |
| RefSeq Size | 4895 |
| RefSeq ORF | 573 |
| Synonyms | HLP4 |
| Locus ID | 51440 |
| Cytogenetics | 1p34.2 |
| Summary | The protein encoded by this gene is highly similar to human hippocalcin protein and hippocalcin like-1 protein. It also has similarity to rat neural visinin-like Ca2+-binding protein-type 1 and 2 proteins. This encoded protein may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. The transcript of this gene has multiple polyadenylation sites. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414097 | HPCAL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414097 | Transient overexpression lysate of hippocalcin like 4 (HPCAL4) |
CNY 3080.00 |
|
| TP305253 | Recombinant protein of human hippocalcin like 4 (HPCAL4), 20 µg |
CNY 2900.00 |
