PIP5K2 alpha (PIP4K2A) (NM_005028) Human Mass Spec Standard
CAT#: PH305243
PIP4K2A MS Standard C13 and N15-labeled recombinant protein (NP_005019)
View other "PIP5K2 alpha" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PIP4K2A MS Standard C13 and N15-labeled recombinant protein (NP_005019) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205243 |
| Predicted MW | 46.2 kDa |
| Protein Sequence |
>RC205243 protein sequence
Red=Cloning site Green=Tags(s) MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVMLMPDDFKAYS KIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDK RYIIKTITSEDVAEMHNILKKYHQYIVECHGITLLPQFLGMYRLNVDGVEIYVIVTRNVFSHRLSVYRKY DLKGSTVAREASDKEKAKELPTLKDNDFINEGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGI HDVERAEQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRK EVYFMAIIDILTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHILT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005019 |
| RefSeq Size | 3833 |
| RefSeq ORF | 1218 |
| Synonyms | PI5P4KA; PIP5K2A; PIP5KII-alpha; PIP5KIIA; PIPK |
| Locus ID | 5305 |
| Cytogenetics | 10p12.2 |
| Summary | Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility. The protein encoded by this gene is one of a family of enzymes capable of catalyzing the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. The amino acid sequence of this enzyme does not show homology to other kinases, but the recombinant protein does exhibit kinase activity. This gene is a member of the phosphatidylinositol-5-phosphate 4-kinase family. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417590 | PIP4K2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417590 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, alpha (PIP4K2A) |
CNY 3080.00 |
|
| TP305243 | Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, alpha (PIP4K2A), 20 µg |
CNY 2900.00 |
其它PIP5K2 alpha产品
