LRRC20 (NM_207119) Human Mass Spec Standard
CAT#: PH305227
LRRC20 MS Standard C13 and N15-labeled recombinant protein (NP_997002)
View other "LRRC20" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LRRC20 MS Standard C13 and N15-labeled recombinant protein (NP_997002) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205227 |
| Predicted MW | 20.5 kDa |
| Protein Sequence |
>RC205227 protein sequence
Red=Cloning site Green=Tags(s) MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFM TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKL AAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_997002 |
| RefSeq Size | 3428 |
| RefSeq ORF | 552 |
| Locus ID | 55222 |
| Cytogenetics | 10q22.1 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404053 | LRRC20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413250 | LRRC20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404053 | Transient overexpression lysate of leucine rich repeat containing 20 (LRRC20), transcript variant 1 |
CNY 3080.00 |
|
| LY413250 | Transient overexpression lysate of leucine rich repeat containing 20 (LRRC20), transcript variant 3 |
CNY 3080.00 |
|
| TP305227 | Recombinant protein of human leucine rich repeat containing 20 (LRRC20), transcript variant 1, 20 µg |
CNY 2900.00 |
