PLSCR4 (NM_020353) Human Mass Spec Standard
CAT#: PH305184
PLSCR4 MS Standard C13 and N15-labeled recombinant protein (NP_065086)
View other "PLSCR4" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PLSCR4 MS Standard C13 and N15-labeled recombinant protein (NP_065086) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205184 |
| Predicted MW | 37 kDa |
| Protein Sequence |
>RC205184 protein sequence
Red=Cloning site Green=Tags(s) MSGVVPTAPEQPAGEMENQTKPPDPRPDAPPEYNSHFLPGPPGTAVPPPTGYPGGLPMGYYSPQQPSTFP LYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETN NRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSARQELE VQCPPGVTIGFVAEHWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGSIIRKWN GLLSAMADADHFDIHFPLDLDVKMKAMIFGACFLIDFMYFERSPPQRSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_065086 |
| RefSeq Size | 3312 |
| RefSeq ORF | 987 |
| Synonyms | TRA1 |
| Locus ID | 57088 |
| Cytogenetics | 3q24 |
| Summary | May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412524 | PLSCR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426943 | PLSCR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426944 | PLSCR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432718 | PLSCR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412524 | Transient overexpression lysate of phospholipid scramblase 4 (PLSCR4), transcript variant 2 |
CNY 3080.00 |
|
| LY426943 | Transient overexpression lysate of phospholipid scramblase 4 (PLSCR4), transcript variant 1 |
CNY 3080.00 |
|
| LY426944 | Transient overexpression lysate of phospholipid scramblase 4 (PLSCR4), transcript variant 3 |
CNY 3080.00 |
|
| LY432718 | Transient overexpression lysate of phospholipid scramblase 4 (PLSCR4), transcript variant 5 |
CNY 3080.00 |
|
| TP305184 | Recombinant protein of human phospholipid scramblase 4 (PLSCR4), transcript variant 2, 20 µg |
CNY 2900.00 |
