SRPK2 (NM_182691) Human Mass Spec Standard
CAT#: PH305134
SRPK2 MS Standard C13 and N15-labeled recombinant protein (NP_872633)
View other "SRPK2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SRPK2 MS Standard C13 and N15-labeled recombinant protein (NP_872633) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205134 |
Predicted MW | 77.5 kDa |
Protein Sequence |
>RC205134 protein sequence
Red=Cloning site Green=Tags(s) MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCKGGYHP VKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDP NKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKI IHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQA ELLEKRLQEIEELEREAERKIIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEE KEDAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPN AESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDRS RTVSASSTGDLPKAKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAG YSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGEL RHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_872633 |
RefSeq Size | 3780 |
RefSeq ORF | 2064 |
Synonyms | SFRSK2 |
Locus ID | 6733 |
Cytogenetics | 7q22.3 |
Summary | Serine/arginine-rich protein-specific kinase which specifically phosphorylates its substrates at serine residues located in regions rich in arginine/serine dipeptides, known as RS domains and is involved in the phosphorylation of SR splicing factors and the regulation of splicing. Promotes neuronal apoptosis by up-regulating cyclin-D1 (CCND1) expression. This is done by the phosphorylation of SRSF2, leading to the suppression of p53/TP53 phosphorylation thereby relieving the repressive effect of p53/TP53 on cyclin-D1 (CCND1) expression. Phosphorylates ACIN1, and redistributes it from the nuclear speckles to the nucleoplasm, resulting in cyclin A1 but not cyclin A2 up-regulation. Plays an essential role in spliceosomal B complex formation via the phosphorylation of DDX23/PRP28. Can mediate hepatitis B virus (HBV) core protein phosphorylation. Plays a negative role in the regulation of HBV replication through a mechanism not involving the phosphorylation of the core protein but by reducing the packaging efficiency of the pregenomic RNA (pgRNA) without affecting the formation of the viral core particles.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403641 | SRPK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405411 | SRPK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY403641 | Transient overexpression lysate of SFRS protein kinase 2 (SRPK2), transcript variant 2 |
CNY 3080.00 |
|
LY405411 | Transient overexpression lysate of SFRS protein kinase 2 (SRPK2), transcript variant 1 |
CNY 4840.00 |
|
TP305134 | Recombinant protein of human SFRS protein kinase 2 (SRPK2), transcript variant 2, 20 µg |
CNY 2900.00 |