CHAC2 (NM_001008708) Human Mass Spec Standard
CAT#: PH305083
CHAC2 MS Standard C13 and N15-labeled recombinant protein (NP_001008708)
View other "CHAC2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CHAC2 MS Standard C13 and N15-labeled recombinant protein (NP_001008708) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205083 |
| Predicted MW | 20.9 kDa |
| Protein Sequence |
>RC205083 protein sequence
Red=Cloning site Green=Tags(s) MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVG KEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGR NTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001008708 |
| RefSeq Size | 1305 |
| RefSeq ORF | 552 |
| Synonyms | GCG1 |
| Locus ID | 494143 |
| Cytogenetics | 2p16.2 |
| Summary | The protein encoded by this gene is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. It is thought that this gene is upregulated in response to endoplasmic reticulum stress and that the glutathione depletion enhances apoptosis. [provided by RefSeq, Sep 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423355 | CHAC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423355 | Transient overexpression lysate of ChaC, cation transport regulator homolog 2 (E. coli) (CHAC2) |
CNY 3080.00 |
|
| TP305083 | Recombinant protein of human ChaC, cation transport regulator homolog 2 (E. coli) (CHAC2), 20 µg |
CNY 2900.00 |
