FXYD2 (NM_001680) Human Mass Spec Standard
CAT#: PH305076
FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001671)
View other "FXYD2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001671) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205076 |
| Predicted MW | 7.3 kDa |
| Protein Sequence |
>RC205076 protein sequence
Red=Cloning site Green=Tags(s) MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001671 |
| RefSeq Size | 584 |
| RefSeq ORF | 198 |
| Synonyms | ATP1G1; HOMG2 |
| Locus ID | 486 |
| Cytogenetics | 11q23.3 |
| Summary | This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411967 | FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419804 | FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426799 | FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411967 | Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b |
CNY 3080.00 |
|
| LY419804 | Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a |
CNY 3080.00 |
|
| LY426799 | Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c |
CNY 3080.00 |
|
| PH302739 | FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_067614) |
CNY 19520.00 |
|
| PH325122 | FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001120961) |
CNY 19520.00 |
|
| TP302739 | Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b, 20 µg |
CNY 2900.00 |
|
| TP305076 | Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a, 20 µg |
CNY 2900.00 |
|
| TP325122 | Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, 20 µg |
CNY 2900.00 |
