UPRT (NM_145052) Human Mass Spec Standard
CAT#: PH305030
UPRT MS Standard C13 and N15-labeled recombinant protein (NP_659489)
View other "UPRT" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | UPRT MS Standard C13 and N15-labeled recombinant protein (NP_659489) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205030 |
| Predicted MW | 33.8 kDa |
| Protein Sequence |
>RC205030 protein sequence
Red=Cloning site Green=Tags(s) MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSLPAELDSGACG GSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSA DRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQ SDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSII QEFPEITILTTEVHPVAPTHFGQKYFGTD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_659489 |
| RefSeq Size | 2512 |
| RefSeq ORF | 927 |
| Synonyms | FUR1; UPP |
| Locus ID | 139596 |
| Cytogenetics | Xq13.3 |
| Summary | This gene encodes uracil phosphoribosyltransferase, which catalyzes the conversion of uracil and 5-phosphoribosyl-1-R-diphosphate to uridine monophosphate (UMP). This reaction is an important part of nucleotide metabolism, specifically the pyrimidine salvage pathway. The enzyme localizes to the nucleus and cytoplasm. The protein is a potential target for rational design of drugs to treat parasitic infections and cancer. [provided by RefSeq, Nov 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408068 | UPRT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408068 | Transient overexpression lysate of uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae) (UPRT), transcript variant 1 |
CNY 3080.00 |
|
| TP305030 | Recombinant protein of human uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae) (UPRT), 20 µg |
CNY 2900.00 |
|
| TP721007 | Purified recombinant protein of Human uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae) (UPRT), transcript variant 1 |
CNY 1800.00 |
